E3 ubiquitin protein ligase MUL1 (MUL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	mitochondrial E3 ubiquitin protein ligase 1
Database Link	NP_078820 Entrez Gene 79594 Human UniProt ID Q969V5
Background	The function of C1orf166 remains unknown.
Synonyms	C1orf166; GIDE; MAPL; MULAN; RNF218
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Bovine: 92%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.