RUFY1 Rabbit Polyclonal Antibody

CAT#: TA330472

Rabbit Polyclonal Anti-RUFY1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of RUN and FYVE domain containing 1 (RUFY1), transcript variant 1
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human RUN and FYVE domain containing 1 (RUFY1), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human RUN and FYVE domain containing 1 (RUFY1), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RUFY1 antibody: synthetic peptide directed towards the C terminal of human RUFY1. Synthetic peptide located within the following region: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 69 kDa
Gene Name RUN and FYVE domain containing 1
Background RUFY1 contains 1 FYVE-type zinc finger and 1 RUN domain. It binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking.
Synonyms RABIP4; ZFYVE12
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 85%
Reference Data
Protein Pathways Endocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...