PIGW Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIGW antibody: synthetic peptide directed towards the middle region of human PIGW. Synthetic peptide located within the following region: IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	phosphatidylinositol glycan anchor biosynthesis class W
Database Link	NP_848612 Entrez Gene 284098 Human UniProt ID Q7Z7B1
Background	Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol.Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-430 AK094752.1 1-430 431-1570 AB097818.1 376-1515 1571-2255 AK094752.1 1571-2255
Synonyms	Gwt1; HPMRS5
Note	Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.