Uap1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Uap1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LKDANDVPIQCEISPLISYAGEGLEGYVADKEFHAPLIIDENGVHELVKN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	UDP-N-acetylglucosamine pyrophosphorylase 1
Database Link	NP_598567 Entrez Gene 107652 Mouse UniProt ID Q91YN5
Background	The function of this protein remains unknown.
Synonyms	AGX; AGX1; AGX2; SPAG2
Note	Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Zebrafish: 93%; Yeast: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.