Methyltransferase like protein 10 (METTL10) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-METTL10 antibody: synthetic peptide directed towards the N terminal of human LOC399818. Synthetic peptide located within the following region: SSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFRE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	methyltransferase like 10
Database Link	NP_997719 Entrez Gene 399818 Human UniProt ID Q5JPI9
Background	LOC399818 belongs to the methyltransferase superfamily
Synonyms	C10orf138
Note	Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.