TRPV5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	transient receptor potential cation channel subfamily V member 5
Database Link	NP_062815 Entrez Gene 56302 Human UniProt ID Q9NQA5
Background	TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2486 AF304464.1 86-2571
Synonyms	CAT2; ECAC1; OTRPC3
Note	Human: 100%; Pig: 92%; Dog: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Horse: 77%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.