TMPRSS4 Rabbit Polyclonal Antibody

CAT#: TA331094

Rabbit polyclonal Anti-TMPRSS4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1
    • 100 ug

CNY 3,080.00


Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 48 kDa
Gene Name transmembrane protease, serine 4
Background This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms CAPH2; MT-SP2; TMPRSS3
Note Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Guinea pig: 92%; Bovine: 85%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...