TIP30 (HTATIP2) Rabbit Polyclonal Antibody

CAT#: TA331157

Rabbit Polyclonal Anti-HTATIP2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2. Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 27 kDa
Gene Name HIV-1 Tat interactive protein 2
Background CC3 (HTATIP2) is a member of the short-chain dehydrogenases/reductases (SDR) family. It is a novel serine/threonine kinase that phosphorylates the C-terminal domain (CTD) of the largest RNA polymerase II subunit and induces the expression of apoptosis related genes Bad and Siva, as well as metastasis suppressor NM23-H2. It also interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates ERalpha-mediated c-myc transcription.
Synonyms CC3; SDR44U1; TIP30
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...