United States
Germany
Japan
United Kingdom
China
TIP30 (HTATIP2) (NM_001098522) Human Recombinant Protein
CAT＃: TP312332
Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4, 20 µg
View other "TIP30" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212332 protein sequence
Red=Cloning site Green=Tags(s) MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001091992 |
| Locus ID | 10553 |
| UniProt ID | Q9BUP3 |
| Refseq Size | 1719 |
| Cytogenetics | 11p15.1 |
| Refseq ORF | 726 |
| Synonyms | CC3; SDR44U1; TIP30 |
| Summary | Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416670 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420619 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420620 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420621 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416670 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2 |
CNY 3,080.00 |
|
| LY420619 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 3 |
CNY 3,080.00 |
|
| LY420620 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4 |
CNY 3,080.00 |
|
| LY420621 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 5 |
CNY 3,080.00 |
|
| PH300276 | HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_006401) |
CNY 19,520.00 |
|
| PH312332 | HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001091992) |
CNY 19,520.00 |
|
| TP300276 | Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
