KRT85 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KRT85 antibody is: synthetic peptide directed towards the N-terminal region of Human KRT85. Synthetic peptide located within the following region: CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	keratin 85
Database Link	NP_002274 Entrez Gene 3891 Human UniProt ID P78386
Background	The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5.
Synonyms	ECTD4; Hb-5; HB5; hHb5; K85; KRTHB5
Note	Human: 100%; Pig: 93%; Horse: 92%; Sheep: 92%; Bovine: 92%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.