PLSCR4 Rabbit Polyclonal Antibody
CAT#: TA331285
Rabbit Polyclonal Anti-PLSCR4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PLSCR4 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSCR4. Synthetic peptide located within the following region: HWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | phospholipid scramblase 4 |
Database Link | |
Background | PLSCR4 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR4 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. |
Synonyms | TRA1 |
Note | Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%; Bovine: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |