United States
Germany
Japan
United Kingdom
China
PLSCR4 (NM_020353) Human Recombinant Protein
CAT＃: TP305184
Recombinant protein of human phospholipid scramblase 4 (PLSCR4), transcript variant 2, 20 µg
View other "PLSCR4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205184 protein sequence
Red=Cloning site Green=Tags(s) MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065086 |
| Locus ID | 57088 |
| UniProt ID | Q9NRQ2 |
| Refseq Size | 3312 |
| Cytogenetics | 3q24 |
| Refseq ORF | 987 |
| Synonyms | TRA1 |
| Summary | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412524 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426943 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426944 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432718 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412524 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 2 |
CNY 3,080.00 |
|
| LY426943 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 1 |
CNY 3,080.00 |
|
| LY426944 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 3 |
CNY 3,080.00 |
|
| LY432718 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 5 |
CNY 3,080.00 |
|
| PH305184 | PLSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_065086) |
CNY 19,520.00 |
