COX18 Rabbit Polyclonal Antibody
CAT#: TA331421
Rabbit polyclonal Anti-COX18 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-COX18 antibody: synthetic peptide directed towards the middle region of human COX18. Synthetic peptide located within the following region: LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | COX18 cytochrome c oxidase assembly factor |
Database Link | |
Background | COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.COX18 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox18 protein catalyzes the insertion of the Cox2 (MTCO2; MIM 516040) C-terminal tail into the mitochondrial inner membrane, an intermediate step in the assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1248 AY957565.1 1-1248 1249-4523 AC095053.3 75071-78345 c |
Synonyms | COX18HS |
Note | Human: 100%; Rat: 93%; Pig: 86%; Horse: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |