Zhx2 Rabbit Polyclonal Antibody
CNY 4,537.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZHX2 antibody: synthetic peptide directed towards the C terminal of mouse ZHX2. Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 92 kDa |
Gene Name | zinc fingers and homeoboxes 2 |
Database Link | |
Background | ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis. |
Synonyms | AFR1; KIAA0854; RAF |
Note | Rat: 100%; Mouse: 100%; Pig: 93%; Dog: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%; Human: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |