DIPK2B Rabbit Polyclonal Antibody
CAT#: TA331575
Rabbit Polyclonal Anti-CXorf36 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CXorf36 Antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf36. Synthetic peptide located within the following region: DKQEGSQEANRAGENKDIFSCLVSGCQAQLPSCESISEKQSLVLVCQKLL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | chromosome X open reading frame 36 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | 4930578C19Rik; bA435K1.1; DIA1R; EPQL1862; PRO3743 |
Note | Immunogen sequence homology: Human: 100%; Horse: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |