CALML6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CALML6 Antibody is: synthetic peptide directed towards the C-terminal region of Human CALML6. Synthetic peptide located within the following region: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	calmodulin like 6
Database Link	NP_619650 Entrez Gene 163688 Human UniProt ID Q8TD86
Background	The function of this protein remains unknown.
Synonyms	CAGLP
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 79%; Bovine: 79%
Reference Data
Protein Pathways	Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.