CDC42SE2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CDC42SE2 Antibody is: synthetic peptide directed towards the middle region of Human CDC42SE2. Synthetic peptide located within the following region: NFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	9 kDa
Gene Name	CDC42 small effector 2
Database Link	NP_064625 Entrez Gene 56990 Human UniProt ID Q9NRR3
Background	CDC42SE2 is probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. It alters CDC42-induced cell shape changes. In activated T-cells, CDC42SE2 may play a role in CDC42-mediated F-actin accumulation at the immunological synapse and may play a role in early contractile events in phagocytosis in macrophages.
Synonyms	SPEC2
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.