ABCA7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	237 kDa
Gene Name	ATP binding cassette subfamily A member 7
Database Link	NP_061985 Entrez Gene 27403 Mouse UniProt ID Q8IZY2
Background	Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation.
Synonyms	ABCA-SSN; ABCX; AD9
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ABC transporters

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.