ENTPD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	ectonucleoside triphosphate diphosphohydrolase 6 (putative)
Database Link	NP_001238 Entrez Gene 955 Human UniProt ID O75354
Background	The function of this protein remains unknown.
Synonyms	CD39L2; dJ738P15.3; IL-6SAG; IL6ST2; NTPDase-6
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Rabbit: 86%
Reference Data
Protein Families	Secreted Protein, Transmembrane
Protein Pathways	Purine metabolism, Pyrimidine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.