ACOXL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ACOXL Antibody is: synthetic peptide directed towards the C-terminal region of Human ACOXL. Synthetic peptide located within the following region: AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	acyl-CoA oxidase-like
Database Link	NP_001136279 Entrez Gene 55289 Human UniProt ID Q9NUZ1
Background	The function of this protein remains unknown.
Synonyms	FLJ11042
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%; Horse: 91%; Dog: 85%; Pig: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.