YARS2 Rabbit Polyclonal Antibody
CAT#: TA332234
Rabbit Polyclonal Anti-YARS2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | tyrosyl-tRNA synthetase 2 |
Database Link | |
Background | This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2). |
Synonyms | CGI-04; MLASA2; MT-TYRRS; TYRRS |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |