Fam110a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Fam110a Antibody is: synthetic peptide directed towards the C-terminal region of Rat Fam110a. Synthetic peptide located within the following region: SPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLAR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	family with sequence similarity 110, member A
Database Link	NP_001014072 Entrez Gene 311535 Rat
Background	The function of this protein remains unknown.
Synonyms	bA371L19.3; C20orf55; F10; MGC2450; MGC4675; OTTHUMP00000029943; OTTHUMP00000029944; OTTHUMP00000029945
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 83%; Zebrafish: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.