SLC36A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Slc36a4 Antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Slc36a4. Synthetic peptide located within the following region: RPLINEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	solute carrier family 36 member 4
Database Link	NP_689526 Entrez Gene 234967 Mouse UniProt ID Q6YBV0
Background	Slc36a4 functions as a sodium-independent electroneutral transporter for tryptophan, proline and alanine.
Synonyms	PAT4
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Bovine: 93%; Mouse: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.