SNAIL (SNAI1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	snail family transcriptional repressor 1
Database Link	NP_005976 Entrez Gene 20613 MouseEntrez Gene 6615 Human UniProt ID O95863
Background	The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo.
Synonyms	dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Adherens junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.