INPP5A Rabbit Polyclonal Antibody

CAT#: TA333940

Rabbit Polyclonal Anti-INPP5A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of inositol polyphosphate-5-phosphatase, 40kDa (INPP5A)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human inositol polyphosphate-5-phosphatase, 40kDa (INPP5A), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human inositol polyphosphate-5-phosphatase, 40kDa (INPP5A), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-INPP5A Antibody is: synthetic peptide directed towards the C-terminal region of Human INPP5A. Synthetic peptide located within the following region: VVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name inositol polyphosphate-5-phosphatase A
Background The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.
Synonyms 5PTASE
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...