DMT1 (SLC11A2) Rabbit Polyclonal Antibody
CAT#: TA334160
Rabbit Polyclonal Anti-SLC11A2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC11A2 Antibody: synthetic peptide directed towards the N terminal of human SLC11A2. Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | solute carrier family 11 member 2 |
Database Link | |
Background | The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | DCT1; DMT1; NRAMP2 |
Note | Immunogen sequence homology: Human: 100%; Rat: 91% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Lysosome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Differential regulation of estrogen in iron metabolism in astrocytes and neurons
,Xu, M;Tan, X;Li, N;Wu, H;Wang, Y;Xie, J;Wang, J;,
J. Cell. Physiol.
,PubMed ID 30132882
[SLC11A2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |