ZNF96 (ZSCAN12) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZSCAN12 antibody: synthetic peptide directed towards the middle region of human ZSCAN12. Synthetic peptide located within the following region: RLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	zinc finger and SCAN domain containing 12
Database Link	NP_001034732 Entrez Gene 9753 Human
Background	The exact function of this protein remains unknown.
Synonyms	dJ29K1.2; KIAA0426; ZFP96; zinc finger and SCAN domain containing 12; zinc finger protein 96; zinc finger protein 305; ZNF29K1; ZNF96; ZNF305; ZSCAN12
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.