GLUD2 Rabbit Polyclonal Antibody

CAT#: TA334426

Rabbit Polyclonal Anti-GLUD2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human glutamate dehydrogenase 2 (GLUD2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human glutamate dehydrogenase 2 (GLUD2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 61 kDa
Gene Name glutamate dehydrogenase 2
Background Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2348 BC050732.2 1-2348
Synonyms GDH2; GLUDP1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...