Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
CAT#: TA334682
Rabbit Polyclonal Anti-PTHLH Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,381.00
Cited in 2 publications. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | parathyroid hormone-like hormone |
Database Link | |
Background | PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. |
Synonyms | BDE2; HHM; PLP; PTHR; PTHRP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Mouse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
Cyclooxygenase-2 regulates PTHrP transcription in human articular chondrocytes and is involved in the pathophysiology of osteoarthritis in rats
,null,
Journal of Orthopaedic Translation
,PubMed ID 34466385
[PTHLH]
|
Parathyroid hormone-related peptide (1-34) promotes tooth eruption and inhibits osteogenesis of dental follicle cells during tooth development
,Zhang, J;Liao, L;Li, Y;Xu, Y;Guo, W;Tian, W;Zou, S;,
J. Cell. Physiol.
,PubMed ID 30584670
[PTHLH]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Parathyroid hormone related protein产品