CCNYL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCNYL1 antibody is: synthetic peptide directed towards the middle region of Human CCNYL1. Synthetic peptide located within the following region: AELDFGEGEGHHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	cyclin Y like 1
Database Link	NP_689736 Entrez Gene 151195 Human UniProt ID Q8N7R7
Background	The function of this protein remains unknown.
Synonyms	FLJ40432
Note	Immunogen Sequence Homology: Human: 100%; Dog: 90%; Pig: 90%; Rat: 90%; Horse: 90%; Mouse: 90%; Bovine: 90%; Rabbit: 90%; Zebrafish: 90%; Guinea pig: 90%; Goat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.