C10orf68 (CCDC7) Rabbit Polyclonal Antibody

CAT#: TA334959

Rabbit Polyclonal Anti-CCDC7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human coiled-coil domain containing 7 (CCDC7), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of coiled-coil domain containing 7 (CCDC7), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human coiled-coil domain containing 7 (CCDC7), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of coiled-coil domain containing 7 (CCDC7), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CCDC7 antibody: synthetic peptide directed towards the N terminal of human CCDC7. Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name coiled-coil domain containing 7
Background The exact function of CCDC7 remains unknown.
Synonyms BioT2-A; BioT2-B; BioT2-C; C10orf68
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...