LCLAT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	lysocardiolipin acyltransferase 1
Database Link	NP_001002257 Entrez Gene 253558 Human UniProt ID Q6UWP7
Background	LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
Synonyms	1AGPAT8; AGPAT8; ALCAT1; HSRG1849; LYCAT; UNQ1849
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Limonene and pinene degradation, Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.