Transmembrane Protein 175 (TMEM175) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	transmembrane protein 175
Database Link	NP_115702 Entrez Gene 84286 Human UniProt ID Q9BSA9
Background	The MGC4618 is a hypothetical protein found in Chromosome 4.
Synonyms	hTMEM175
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.