WDPCP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-WDPCP Antibody: synthetic peptide directed towards the N terminal of human LOC51057. Synthetic peptide located within the following region: LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	WD repeat containing planar cell polarity effector
Database Link	NP_056994 Entrez Gene 51057 Human UniProt ID O95876
Background	The specific function of this protein remains unknown.
Synonyms	BBS15; C2orf86; CHDTHP; FRITZ; FRTZ
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 92%; Mouse: 91%; Dog: 85%; Bovine: 85%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.