Il5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	interleukin 5
Database Link	NP_034688 Entrez Gene 16191 Mouse UniProt ID P04401
Background	The function of Il5 remains unknown.
Synonyms	EDF; IL-5; interleukin-5; TRF
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.