YB1 (YBX1) Rabbit Polyclonal Antibody
CAT#: TA335743
Rabbit Polyclonal Anti-NSEP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NSEP1 Antibody: synthetic peptide directed towards the C terminal of human NSEP1. Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | Y-box binding protein 1 |
Database Link | |
Background | NSEP1 is a cell cycle stage-specific transcription factor important for cell proliferation. NSEP1 encodes a protein that correlates with P-glycoprotein expression in human breast carcinoma. |
Synonyms | BP-8; CSDA2; CSDB; DBPB; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 92% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |