YB1 (YBX1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NSEP1 Antibody: synthetic peptide directed towards the C terminal of human NSEP1. Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	Y-box binding protein 1
Database Link	NP_004550 Entrez Gene 4904 Human UniProt ID P67809
Background	NSEP1 is a cell cycle stage-specific transcription factor important for cell proliferation. NSEP1 encodes a protein that correlates with P-glycoprotein expression in human breast carcinoma.
Synonyms	BP-8; CSDA2; CSDB; DBPB; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 92%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.