YB1 (YBX1) (NM_004559) Human Recombinant Protein
CAT#: TP309835
Purified recombinant protein of Homo sapiens Y box binding protein 1 (YBX1), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209835 protein sequence
Red=Cloning site Green=Tags(s) MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRN GYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA DRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSN PPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRR YRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004550 |
Locus ID | 4904 |
UniProt ID | P67809 |
Refseq Size | 1561 |
Cytogenetics | 1p34.2 |
Refseq ORF | 972 |
Synonyms | BP-8; CBF-A; CSDA2; CSDB; DBPB; EFI-A; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1 |
Summary | This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Sep 2015] |
Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Single mRNP Analysis Reveals that Small Cytoplasmic mRNP Granules Represent mRNA Singletons
,Mateu-Regué, À;Christiansen, J;Bagger, FO;Winther, O;Hellriegel, C;Nielsen, FC;,
Cell Rep
,PubMed ID 31618640
[YBX1]
|
Single mRNP analysis by super-resolution microscopy and fluorescence correlation spectroscopy reveals that small mRNP granules represent mRNA singletons
,Mateu-Regue, A;Christiansen, J;Bagger, FO;,
bioRxiv
[YBX1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417905 | YBX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417905 | Transient overexpression lysate of Y box binding protein 1 (YBX1) |
CNY 3,080.00 |
|
PH309835 | YBX1 MS Standard C13 and N15-labeled recombinant protein (NP_004550) |
CNY 14,250.00 |