ENC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ENC1 Antibody: synthetic peptide directed towards the N terminal of human ENC1. Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	ectodermal-neural cortex 1
Database Link	NP_003624 Entrez Gene 8507 Human UniProt ID O14682
Background	ENC1 encodes an actin-binding protein,which is involved in the regulation of neuronal process formation and in differentiation of neural crest cells. May be down-regulated in neuroblastoma tumors. Substrate-specific adapter of an E3 ubiquitin-protein liga
Synonyms	CCL28; ENC-1; KLHL35; KLHL37; NRPB; PIG10; TP53I10
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.