MUM1 (IRF4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	interferon regulatory factor 4
Database Link	NP_002451 Entrez Gene 3662 Human UniProt ID Q15306
Background	IRF4 is a transcriptional activator. It binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter.It also binds the immunoglobulin lambda light chain enhancer, together with PU.1. IRF4 probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.
Synonyms	LSIRF; MUM1; NF-EM5; SHEP8
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.