ASPDH Rabbit Polyclonal Antibody
CAT#: TA335903
Rabbit Polyclonal Anti-ASPDH Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ASPDH Antibody: synthetic peptide directed towards the N terminal of human LOC554235. Synthetic peptide located within the following region: VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | aspartate dehydrogenase domain containing |
Database Link | |
Background | The specific function of this protein remains unknown. |
Synonyms | aspartate dehydrogenase; aspartate dehydrogenase domain containing |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 92%; Bovine: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |