PTRH2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PTRH2 Antibody: synthetic peptide directed towards the C terminal of human PTRH2. Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	peptidyl-tRNA hydrolase 2
Database Link	NP_001015509 Entrez Gene 51651 Human UniProt ID Q9Y3E5
Background	The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
Synonyms	BIT1; CFAP37; CGI-147; IMNEPD; PTH; PTH 2; PTH2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.