PHF17 (JADE1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the C terminal of human PHF17. Synthetic peptide located within the following region: YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	jade family PHD finger 1
Database Link	NP_079176 Entrez Gene 79960 Human UniProt ID Q6IE81
Background	PHF17 belongs to the JADE family. It contains 2 PHD-type zinc fingers. PHF17 is a transcriptional coactivator which seems to act by promoting acetylation of nucleosomal histone H4 by HTATIP. PHF17 promotes apoptosis. Itmay act as a renal tumor suppressor.
Synonyms	PHF17
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.