NR1D1 Rabbit Polyclonal Antibody
CAT#: TA338008
Rabbit Polyclonal Anti-NR1D1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 67 kDa |
Gene Name | nuclear receptor subfamily 1 group D member 1 |
Database Link | |
Background | This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein represses the circadian clock transcription factor aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL). This protein may also be involved in regulating genes that function in metabolic, inflammatory and cardiovascular processes. [provided by RefSeq, Jan 2013] |
Synonyms | ear-1; EAR1; hRev; THRA1; THRAL |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Rat: 92%; Sheep: 86%; Bovine: 86%; Horse: 85% |
Reference Data | |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Circadian rhythm - mammal |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |