CPS1 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Pig |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 165 kDa |
Gene Name | carbamoyl-phosphate synthase 1 |
Database Link | |
Background | The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation. [provided by RefSeq, May 2010] |
Synonyms | CPSASE1; PHN |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%; Yeast: 77% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |