CDH19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDH19 antibody is: synthetic peptide directed towards the middle region of Human CDH19. Synthetic peptide located within the following region: LLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	cadherin 19
Database Link	NP_001257957 Entrez Gene 28513 Human UniProt ID Q9H159
Background	This gene is one of three related type II cadherin genes situated in a cluster on chromosome 18. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein containing five extracellular cadherin repeats. Loss of cadherins may be associated with cancer formation. Alternative splicing results in multiple transcript variants for this gene.
Synonyms	CDH7; CDH7L2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.