EME1 Rabbit Polyclonal Antibody

CAT#: TA338859

Rabbit Polyclonal Anti-EME1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EME1 antibody: synthetic peptide directed towards the middle region of human EME1. Synthetic peptide located within the following region: AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 63 kDa
Gene Name essential meiotic structure-specific endonuclease 1
Background EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003 [PubMed 14609959]). [supplied by OMIM]
Synonyms MMS4L; SLX2A
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 79%
Reference Data
Protein Pathways Homologous recombination
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...