ZBTB22 Rabbit Polyclonal Antibody
CAT#: TA339111
Rabbit Polyclonal Anti-ZBTB22 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZBTB22 antibody: synthetic peptide directed towards the C terminal of human ZBTB22. Synthetic peptide located within the following region: MQGNQILVFPSSSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 66 kDa |
Gene Name | zinc finger and BTB domain containing 22 |
Database Link | |
Background | May be involved in transcriptional regulation. |
Synonyms | BING1; fru; fruitless; ZBTB22A; ZNF297; ZNF297A |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |