ZNF75 (ZNF75D) Rabbit Polyclonal Antibody
CAT#: TA339145
Rabbit Polyclonal Anti-ZNF75 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF75 antibody: synthetic peptide directed towards the middle region of human ZNF75. Synthetic peptide located within the following region: LALSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | zinc finger protein 75D |
Database Link | |
Background | This gene encodes a protein that likely functions as a transcription factor. The protein, which belongs to the ZNF75 family, includes an N-terminal SCAN domain, a KRAB box, and five C2H2-type zinc finger motifs. Another functional gene belonging to this family is located on chromosome 16, while pseudogenes have been identified on chromosomes 11 and 12. Alternative splicing results in multiple transcripts variants. [provided by RefSeq, Jun 2010] |
Synonyms | D8C6; ZKSCAN24; ZNF75; ZNF82; ZSCAN28 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |