MCCC2 Rabbit Polyclonal Antibody
CAT#: TA339356
Rabbit Polyclonal Anti-MCCC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MCCC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MCCC2. Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | methylcrotonoyl-CoA carboxylase 2 |
Database Link | |
Background | This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. [provided by RefSeq, Jul 2008] |
Synonyms | MCCB |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Valine, leucine and isoleucine degradation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |