KCNC1 Rabbit Polyclonal Antibody

CAT#: TA339437

Rabbit Polyclonal Anti-KCNC1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (2)
Transient overexpression lysate of potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KCNC1 antibody: synthetic peptide directed towards the N terminal of human KCNC1. Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 58 kDa
Gene Name potassium voltage-gated channel subfamily C member 1
Background The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. Multiple transcript variants encoding different isoforms have been inferred for this gene based on orthologous loci. [provided by RefSeq, Jul 2008]
Synonyms EPM7; KV3.1; KV4; NGK2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...